PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa09g088920.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family B3
Protein Properties Length: 545aa    MW: 62299 Da    PI: 7.8846
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa09g088920.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B343.84.5e-1423981196
                    HHTT-EE--HHH.HTT..---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
              B3 11 lksgrlvlpkkfaeeh..ggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96
                    ++ + l +p  f+ ++  g++  e+ t +l++  s  +Wevk+  ++++    l+ GW +F+ a++L++gD+vvF+++g    elv++v
  Csa09g088920.1 23 FTDH-LDIPVAFFLKYvvGSN--EGNTAKLRSdASDTTWEVKI--DGRR----LSHGWDDFAIAHDLRVGDIVVFRHEG----ELVFHV 98
                    4445.99*********87655..5568888886899*******..9998....99*********************765....444444 PP

2B362.47.3e-20150243297
                     EEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTE.EEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
              B3   2 fkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgr.yvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                     f +++++++l+++ l+lpk+fa+++g+k+  + +++l++e+g+sW + l+++ ++++ + +++GW++F+ ang k gD ++Fkl+++ e+++v++
  Csa09g088920.1 150 FVTTVTASNLRRDTLYLPKEFARSNGLKN--KLKIVLMNEEGESWIIDLRHEAYPSGrFNMRRGWRRFCVANGKKPGDKMLFKLVQN-EETPVLQ 241
                     5677899******************9995..458***************995555444**************************995.5558887 PP

                     EE CS
              B3  96 vf 97 
                     +f
  Csa09g088920.1 242 LF 243
                     76 PP

3B361.81.1e-19280369697
                     ..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
              B3   6 tpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                     ++ ++l ++r++lpkkf+ + g++  +++++ l++e+g+sW++ ++++ +sgr++ t+GW++F+ an+ k gD+++Fkl+++ ++ +v++vf
  Csa09g088920.1 280 VTTSNLWRDRMYLPKKFILSSGLS-LKTFQILLMNEEGESWKIDVRHEAYSGRFLTTRGWRSFCVANDKKPGDSFIFKLVQN-QEIPVLRVF 369
                     567778889*********999877.67899*************************************************995.444677665 PP

4B341.22.9e-134625431499
                     T-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
              B3  14 grlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                     + l lp +f++++g++k++  ++t+ d  g +W+  l +++++ ++ l+kG ++F++ +g+k  +++v++l++ +++ +++k+++k
  Csa09g088920.1 462 SKLNLPLEFTKANGINKAG--KITMLDIYGSRWRTSLLMDNRG-TMSLGKGSNGFCEVHGVKMYESFVLELIW-EDTVPLLKFCSK 543
                     5689************887..7***************766665.678**************************.788899999987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.103.2E-209106IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019365.49E-2010110IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.47612104IPR003340B3 DNA binding domain
CDDcd100171.55E-151399No hitNo description
SMARTSM010191.4E-2015104IPR003340B3 DNA binding domain
PfamPF023621.4E-82597IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.103.8E-22147240IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086315.622149246IPR003340B3 DNA binding domain
CDDcd100172.85E-17149244No hitNo description
SuperFamilySSF1019369.22E-21149245IPR015300DNA-binding pseudobarrel domain
PfamPF023628.2E-19150243IPR003340B3 DNA binding domain
SMARTSM010191.3E-31150246IPR003340B3 DNA binding domain
SuperFamilySSF1019369.02E-19270366IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.104.7E-18271366IPR015300DNA-binding pseudobarrel domain
CDDcd100171.08E-17275370No hitNo description
PROSITE profilePS5086313.549275372IPR003340B3 DNA binding domain
SMARTSM010196.5E-26276372IPR003340B3 DNA binding domain
PfamPF023621.0E-17279369IPR003340B3 DNA binding domain
PROSITE profilePS508639.136449543IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.0E-13450543IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019365.49E-14451543IPR015300DNA-binding pseudobarrel domain
SMARTSM010191.4E-19453544IPR003340B3 DNA binding domain
PfamPF023621.4E-11462543IPR003340B3 DNA binding domain
CDDcd100176.17E-9462542No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 545 aa     Download sequence    Send to blast
MVNQQPLYSP INPHFFQPLL PDFTDHLDIP VAFFLKYVVG SNEGNTAKLR SDASDTTWEV  60
KIDGRRLSHG WDDFAIAHDL RVGDIVVFRH EGELVFHVSA LGPSCCEIQY RDDKKEKLCD  120
TVTEKVSIQK KSLKREAADS APDHSLDSCF VTTVTASNLR RDTLYLPKEF ARSNGLKNKL  180
KIVLMNEEGE SWIIDLRHEA YPSGRFNMRR GWRRFCVANG KKPGDKMLFK LVQNEETPVL  240
QLFPMDSEDQ EKLENVPRKK SRKEEEDYSP DDCSSFVASV TTSNLWRDRM YLPKKFILSS  300
GLSLKTFQIL LMNEEGESWK IDVRHEAYSG RFLTTRGWRS FCVANDKKPG DSFIFKLVQN  360
QEIPVLRVFP LYSEDWHKLE PSNDTRQGKC LKATKAEFLG VEVYRDDSMQ GNCFKASVAE  420
PTDEDIRQRR RSQAIKQEYV SAEGNYSIGQ NRLVTLTLTP ASKLNLPLEF TKANGINKAG  480
KITMLDIYGS RWRTSLLMDN RGTMSLGKGS NGFCEVHGVK MYESFVLELI WEDTVPLLKF  540
CSKV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010429457.10.0PREDICTED: B3 domain-containing protein REM10-like
SwissprotP0DH850.0REM10_ARATH; B3 domain-containing protein REM10
TrEMBLR0FW980.0R0FW98_9BRAS; Uncharacterized protein
STRINGfgenesh1_pg.C_scaffold_40003920.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM144901522
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24700.10.0B3 family protein